![]() The fusion protein according to claim 1, wherein the class I fusion protein is an influenza hemagglutinin (HA) polypeptide of an influenza B virus.Ģ3. LKSTQAAINQINGKLNRLIGKTNEKFHQIEKEFSEPEGRIQDLEKYVEDTĢ2. LKSTQAAINQINGKLNRLIGKTNEKPHQIEKEFSEVEGRIQDLEKYVEDT The fusion protein according to claim 19, wherein the class I fusion protein is an influenza H3 hemagglutinin (HA) protein comprising an amino acid sequence selected from the group consisting of: (SEQ ID NO: 23) The fusion protein according to claim 19, comprising a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Phe at position 72 and/or a mutation of the amino acid residue Val at position 82.Ģ1. The fusion protein according to claim 1, wherein the class I fusion protein is an influenza H3 hemagglutinin (HA) protein.Ģ0. QKSTQNAINGITNKVNSVIEKMNTQFTAVGKEFNKPERRMENLNKKVDDGġ9. QKSTQNAINGITNKVNSVIEKMNTQPTAVGKEFNKLERRMENLNKKVDDG The fusion protein according to claim 16, wherein the class I fusion protein is an influenza H1 hemagglutinin (HA) protein comprising an amino acid sequence selected from the group consisting of: (SEQ ID NO: 19) The fusion protein according to claim 16, comprising a mutation in the hinge loop (B-loop) of HA2 of the amino acid residue Phe at position 63 and/or a mutation of the amino acid residue Leu at position 73.ġ8. The fusion protein according to claim 1, wherein the class I fusion protein is an influenza H1 hemagglutinin (HA) protein.ġ7. The fusion protein according to claim 13, wherein the class I fusion protein is a HIV-2 envelope protein comprising an amino acid sequence selected from the group consisting of: (SEQ ID NO: 31)ġ6. The fusion protein according to claim 13, comprising a mutation in the hinge loop of the amino acid residue Leu on position 553 and/or a mutation of amino acid residue Leu on position 554, a mutation of amino acid residue Ala at position 556, and/or a mutation of amino acid residue Val at position 557.ġ5. The fusion protein according to claim 1, wherein the class I fusion protein is a retroviral HIV-2 envelope protein.ġ4. QARQLLSGIVQQQSNLLRPIEAQQHMLQLTVWGIKQLQTRV.ġ3. QARQLLSGIVQQQSNLPRAIEAQQHMLQLTVWGIKQLQTRV QARQLLSGIVQQQSNPLRAIEAQQHMLQLTVWGIKQLQTRV QARQLLSGIVQQQNNLLRPIEAQQEILLQLTVWGIKQLQARI QARQLLSGIVQQQNNLPRAIEAQQHLLQLTVWGIKQLQARI QARQLLSGIVQQQNNPLRAIEAQQHLLQLTVWGIKQLQARI The fusion protein according to claim 10, wherein the class I fusion protein is a HIV-1 envelope protein comprising an amino acid sequence selected from the group consisting of: (SEQ ID NO: 3) The fusion protein according to claim 10, comprising a mutation in the hinge loop of the amino acid residue Leu on position 555, a mutation of amino acid residue Leu on position 556, and/or a mutation of the amino acid residue Ala at position 558.ġ2. The fusion protein according to claim 1, wherein the class I fusion protein is a retroviral HIV-1 envelope protein.ġ1. ![]() NLVCRLRRLANQTAKSLELLLRVTTEPRTFSLINRHAIDFLLAR.ġ0. NLVCRLRRLANQTAKSLELLLRVTPEERTFSLINRHAIDFLLAR The fusion protein according to claim 6, wherein the class I fusion protein is a Marburg virus F protein comprising an amino acid sequence selected from the group consisting of: (SEQ ID NO: 15) The fusion protein according to claim 6, comprising a mutation in the hinge loop of the amino acid residue Thr at position 578, and/or a mutation of the amino acid residue Glu at position 580.Ĩ. The fusion protein according to claim 2, wherein the filovirus F protein is a Marburg virus F protein.ħ. GLICGLRQLANETTQALQLFLRATTEPRTFSILNRKAIDFLLQR.Ħ. GLICGLRQLANETTQALQLFLRATPELRTFSILNRKAIDFLLQR The fusion protein according to claim 1, wherein the class I fusion protein is an Ebola virus F protein comprising an amino acid sequence selected from the group consisting of: (SEQ ID NO: 11) The fusion protein according to claim 3, comprising a mutation in the hinge loop of the amino acid residue Thr at position 577 and/or a mutation of the amino acid residue Leu at position 579.ĥ. The fusion protein according to claim 2, wherein the filovirus F protein is an Ebola virus F protein.Ĥ. The fusion protein according to claim 1, wherein the class I fusion protein is a filovirus fusion F protein.ģ. A stable pre-fusion class I fusion protein, comprising one or more mutations in the hinge-loop that is present between the base helix and the RR1.Ģ.
0 Comments
Leave a Reply. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |